| Name | SLAMF6 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7224 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | SLAMF6 antibody was raised using the N terminal of SLAMF6 corresponding to a region with amino acids NFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLK |
| Purity/Format | Affinity purified |
| Blocking Peptide | SLAMF6 Blocking Peptide |
| Description | Rabbit polyclonal SLAMF6 antibody raised against the N terminal of SLAMF6 |
| Gene | SLAMF6 |
| Supplier Page | Shop |