| Name | CDH24 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6134 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | CDH24 antibody was raised using the N terminal of CDH24 corresponding to a region with amino acids NPPIFPLGPYHATVPEMSNVGTSVIQVTAHDADDPSYGNSAKLVYTVLDG |
| Purity/Format | Affinity purified |
| Blocking Peptide | CDH24 Blocking Peptide |
| Description | Rabbit polyclonal CDH24 antibody raised against the N terminal of CDH24 |
| Gene | CDH18 |
| Supplier Page | Shop |