| Name | TBC1D16 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3912 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | TBC1D16 antibody was raised using the N terminal of TBC1D16 corresponding to a region with amino acids EMLGATLILAWVPNSRIQRQDEEALRYITPESSPVRKAPRPRGRRTRSSG |
| Purity/Format | Affinity purified |
| Blocking Peptide | TBC1D16 Blocking Peptide |
| Description | Rabbit polyclonal TBC1D16 antibody raised against the N terminal of TBC1D16 |
| Gene | TBC1D1 |
| Supplier Page | Shop |