Name | FAM82A antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-3367 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse |
Antigen | FAM82A antibody was raised using the middle region of Fam82A corresponding to a region with amino acids WRFARAYGDMYELSTNTQEKKHYANIGKTLSERAINRAPMNGHCHLWYAV |
Purity/Format | Affinity purified |
Blocking Peptide | FAM82A Blocking Peptide |
Description | Rabbit polyclonal FAM82A antibody raised against the middle region of Fam82A |
Gene | RMDN2 |
Supplier Page | Shop |