Name | ZDHHC18 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-7069 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | ZDHHC18 antibody was raised using the middle region of ZDHHC18 corresponding to a region with amino acids SFTDPGILPRATVCEAAALEKQIDNTGSSTYRPPPRTREVLINGQMVKLK |
Purity/Format | Affinity purified |
Blocking Peptide | ZDHHC18 Blocking Peptide |
Description | Rabbit polyclonal ZDHHC18 antibody raised against the middle region of ZDHHC18 |
Gene | ZDHHC18 |
Supplier Page | Shop |