ZDHHC18 antibody

Name ZDHHC18 antibody
Supplier Fitzgerald
Catalog 70R-7069
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen ZDHHC18 antibody was raised using the middle region of ZDHHC18 corresponding to a region with amino acids SFTDPGILPRATVCEAAALEKQIDNTGSSTYRPPPRTREVLINGQMVKLK
Purity/Format Affinity purified
Blocking Peptide ZDHHC18 Blocking Peptide
Description Rabbit polyclonal ZDHHC18 antibody raised against the middle region of ZDHHC18
Gene ZDHHC18
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.