| Name | CHMP4B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4493 |
| Prices | $375.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | CHMP4B antibody was raised using the middle region of CHMP4B corresponding to a region with amino acids RKKRYEKQLAQIDGTLSTIEFQREALENANTNTEVLKNMGYAAKAMKAAH |
| Purity/Format | Affinity purified |
| Blocking Peptide | CHMP4B Blocking Peptide |
| Description | Rabbit polyclonal CHMP4B antibody raised against the middle region of CHMP4B |
| Gene | CHMP4B |
| Supplier Page | Shop |