| Name | YARS antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5037 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | YARS antibody was raised using the N terminal of YARS corresponding to a region with amino acids MGDAPSPEEKLHLITRNLQEVLGEEKLKEILKERELKIYWGTATTGKPHV |
| Purity/Format | Affinity purified |
| Blocking Peptide | YARS Blocking Peptide |
| Description | Rabbit polyclonal YARS antibody raised against the N terminal of YARS |
| Gene | YARS |
| Supplier Page | Shop |