Name | C2ORF42 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-3949 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Rat |
Antigen | C2ORF42 antibody was raised using the C terminal Of C2Orf42 corresponding to a region with amino acids ITRSFIQNRDGTYELFKCPKVEVESIAETYGRIEKQPVLRPLELKTFLKV |
Purity/Format | Affinity purified |
Blocking Peptide | C2ORF42 Blocking Peptide |
Description | Rabbit polyclonal C2ORF42 antibody raised against the C terminal Of C2Orf42 |
Gene | C2orf42 |
Supplier Page | Shop |