| Name | C2ORF42 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3949 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Rat |
| Antigen | C2ORF42 antibody was raised using the C terminal Of C2Orf42 corresponding to a region with amino acids ITRSFIQNRDGTYELFKCPKVEVESIAETYGRIEKQPVLRPLELKTFLKV |
| Purity/Format | Affinity purified |
| Blocking Peptide | C2ORF42 Blocking Peptide |
| Description | Rabbit polyclonal C2ORF42 antibody raised against the C terminal Of C2Orf42 |
| Gene | C2orf42 |
| Supplier Page | Shop |