| Name | MBD2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1031 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | MBD2 antibody was raised using the middle region of MBD2 corresponding to a region with amino acids DCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNT |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | MBD2 Blocking Peptide |
| Description | Rabbit polyclonal MBD2 antibody raised against the middle region of MBD2 |
| Gene | DPEP2 |
| Supplier Page | Shop |