| Name | C14ORF156 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4685 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | C14ORF156 antibody was raised using the N terminal Of C14Orf156 corresponding to a region with amino acids PFDKETGFHRGLGWVQFSSEEGLRNALQQENHIIDGVKVQVHTRRPKLPQ |
| Purity/Format | Affinity purified |
| Blocking Peptide | C14ORF156 Blocking Peptide |
| Description | Rabbit polyclonal C14ORF156 antibody raised against the N terminal Of C14Orf156 |
| Gene | SLIRP |
| Supplier Page | Shop |