| Name | CMTM8 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6363 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | CMTM8 antibody was raised using the middle region of CMTM8 corresponding to a region with amino acids CFNGSAFVLYLSAAVVDASSVSPERDSHNFNSWAASSFFAFLVTICYAGN |
| Purity/Format | Affinity purified |
| Blocking Peptide | CMTM8 Blocking Peptide |
| Description | Rabbit polyclonal CMTM8 antibody raised against the middle region of CMTM8 |
| Gene | CMTM8 |
| Supplier Page | Shop |