AGPAT2 antibody

Name AGPAT2 antibody
Supplier Fitzgerald
Catalog 70R-1770
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen AGPAT2 antibody was raised using the C terminal of AGPAT2 corresponding to a region with amino acids LEAIPTSGLTAADVPALVDTCHRAMRTTFLHISKTPQENGATAGSGVQPA
Purity/Format Total IgG Protein A purified
Blocking Peptide AGPAT2 Blocking Peptide
Description Rabbit polyclonal AGPAT2 antibody raised against the C terminal of AGPAT2
Gene AGPAT2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.