| Name | KIAA1958 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4141 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | KIAA1958 antibody was raised using the C terminal of KIAA1958 corresponding to a region with amino acids SPITLLSTVVKYNSQYLNMRTLQEHADLMYGDIELLKDPQNQPYFARTDS |
| Purity/Format | Affinity purified |
| Blocking Peptide | KIAA1958 Blocking Peptide |
| Description | Rabbit polyclonal KIAA1958 antibody raised against the C terminal of KIAA1958 |
| Gene | KIAA1958 |
| Supplier Page | Shop |