| Name | C2ORF53 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3597 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | C2ORF53 antibody was raised using the middle region of C2Orf53 corresponding to a region with amino acids PQGKATQACGHQLPASQPPAAQARADPVPGTPSQTRSFRSAGLQSPNSPR |
| Purity/Format | Affinity purified |
| Blocking Peptide | C2ORF53 Blocking Peptide |
| Description | Rabbit polyclonal C2ORF53 antibody raised against the middle region of C2Orf53 |
| Gene | PRR30 |
| Supplier Page | Shop |