Synaptojanin 1 antibody

• Supplier: Fitzgerald
• Catalog: 70R-4877
• Prices: $345.00
• Sizes: 50 µg
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: Synaptojanin 1 antibody was raised using the N terminal of SYNJ1 corresponding to a region with amino acids IDSSDEDRISEVRKVLNSGNFYFAWSASGISLDLSLNAHRSMQEQTTDNR
• Purity/Format: Affinity purified
• Blocking Peptide: Synaptojanin 1 Blocking Peptide
• Description: Rabbit polyclonal Synaptojanin 1 antibody raised against the N terminal of SYNJ1
• Gene: SYNJ1