Name | RASGEF1C antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-5807 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | RASGEF1C antibody was raised using the middle region of RASGEF1C corresponding to a region with amino acids FLELAKQVGEFITWKQVECPFEQDASITHYLYTAPIFSEDGLYLASYESE |
Purity/Format | Affinity purified |
Blocking Peptide | RASGEF1C Blocking Peptide |
Description | Rabbit polyclonal RASGEF1C antibody raised against the middle region of RASGEF1C |
Gene | RASGEF1C |
Supplier Page | Shop |