Name | DAGLB antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-7486 |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | DAGLB antibody was raised using the middle region of DAGLB corresponding to a region with amino acids STAELFSTYFSDTDLVPSDIAAGLALLHQQQDNIRNNQEPAQVVCHAPGS |
Purity/Format | Affinity purified |
Blocking Peptide | DAGLB Blocking Peptide |
Description | Rabbit polyclonal DAGLB antibody raised against the middle region of DAGLB |
Gene | DAGLB |
Supplier Page | Shop |