| Name | OSBPL9 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2891 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Dog |
| Antigen | OSBPL9 antibody was raised using the N terminal of OSBPL9 corresponding to a region with amino acids HQTPTPNSTGSGHSPPSSSLTSPSHVNLSPNTVPEFSYSSSEDEFYDADE |
| Purity/Format | Affinity purified |
| Blocking Peptide | OSBPL9 Blocking Peptide |
| Description | Rabbit polyclonal OSBPL9 antibody raised against the N terminal of OSBPL9 |
| Gene | OSBPL9 |
| Supplier Page | Shop |