Name | OSBPL9 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-2891 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | IHC WB |
Species Reactivities | Human, Dog |
Antigen | OSBPL9 antibody was raised using the N terminal of OSBPL9 corresponding to a region with amino acids HQTPTPNSTGSGHSPPSSSLTSPSHVNLSPNTVPEFSYSSSEDEFYDADE |
Purity/Format | Affinity purified |
Blocking Peptide | OSBPL9 Blocking Peptide |
Description | Rabbit polyclonal OSBPL9 antibody raised against the N terminal of OSBPL9 |
Gene | OSBPL9 |
Supplier Page | Shop |