| Name | TMEM24 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7325 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | TMEM24 antibody was raised using the C terminal Of Tmem24 corresponding to a region with amino acids AGLSQSHDDLSNATATPSVRKKAGSFSRRLIKRFSFKSKPKANGNPSPQL |
| Purity/Format | Affinity purified |
| Blocking Peptide | TMEM24 Blocking Peptide |
| Description | Rabbit polyclonal TMEM24 antibody raised against the C terminal Of Tmem24 |
| Gene | C2CD2L |
| Supplier Page | Shop |