| Name | IGLL1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1641 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | IGLL1 antibody was raised using the N terminal of IGLL1 corresponding to a region with amino acids RSRWGRFLLQRGSWTGPRCWPRGFQSKHNSVTHVFGSGTQLTVLSQPKAT |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | IGLL1 Blocking Peptide |
| Description | Rabbit polyclonal IGLL1 antibody raised against the N terminal of IGLL1 |
| Gene | IGLL1 |
| Supplier Page | Shop |