DUS1L antibody

Name DUS1L antibody
Supplier Fitzgerald
Catalog 70R-4013
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen DUS1L antibody was raised using a synthetic peptide corresponding to a region with amino acids KPTGDLPFHWICQPYIRPGPREGSKEKAGARSKRALEEEEGGTEVLSKNK
Purity/Format Affinity purified
Blocking Peptide DUS1L Blocking Peptide
Description Rabbit polyclonal DUS1L antibody
Gene DUS1L
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.