| Name | PLEK antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5839 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | PLEK antibody was raised using the N terminal of PLEK corresponding to a region with amino acids MEPKRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPL |
| Purity/Format | Affinity purified |
| Blocking Peptide | PLEK Blocking Peptide |
| Description | Rabbit polyclonal PLEK antibody raised against the N terminal of PLEK |
| Gene | PLEK |
| Supplier Page | Shop |