BOLL antibody

Name BOLL antibody
Supplier Fitzgerald
Catalog 70R-4749
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen BOLL antibody was raised using a synthetic peptide corresponding to a region with amino acids GGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKGYGFVTFETQEDAQ
Purity/Format Affinity purified
Blocking Peptide BOLL Blocking Peptide
Description Rabbit polyclonal BOLL antibody
Gene BOLL
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.