CDH22 antibody

Name CDH22 antibody
Supplier Fitzgerald
Catalog 70R-1834
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen CDH22 antibody was raised using the N terminal of CDH22 corresponding to a region with amino acids LIDELTGDIHAMERLDREQKTFYTLRAQARDRATNRLLEPESEFIIKVQD
Purity/Format Total IgG Protein A purified
Blocking Peptide CDH22 Blocking Peptide
Description Rabbit polyclonal CDH22 antibody raised against the N terminal of CDH22
Gene CDH22
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.