STIP1 antibody

Name STIP1 antibody
Supplier Fitzgerald
Catalog 70R-1288
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Dog
Antigen STIP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLAERKFMNPFNM
Purity/Format Total IgG Protein A purified
Blocking Peptide STIP1 Blocking Peptide
Description Rabbit polyclonal STIP1 antibody
Gene STIP1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.