| Name | SSR1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6619 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | SSR1 antibody was raised using the middle region of SSR1 corresponding to a region with amino acids FTNKGTEDFIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQRQATFEY |
| Purity/Format | Affinity purified |
| Blocking Peptide | SSR1 Blocking Peptide |
| Description | Rabbit polyclonal SSR1 antibody raised against the middle region of SSR1 |
| Gene | SSR1 |
| Supplier Page | Shop |