MCTP1 antibody

Name MCTP1 antibody
Supplier Fitzgerald
Catalog 70R-6811
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen MCTP1 antibody was raised using the middle region of MCTP1 corresponding to a region with amino acids EVTVYDEDRDRSADFLGKVAIPLLSIQNGEQKAYVLKNKQLTGPTKGVIY
Purity/Format Affinity purified
Blocking Peptide MCTP1 Blocking Peptide
Description Rabbit polyclonal MCTP1 antibody raised against the middle region of MCTP1
Gene MCTP1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.