Annexin A13 antibody

Name Annexin A13 antibody
Supplier Fitzgerald
Catalog 70R-1674
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Dog
Antigen Annexin A13 antibody was raised using the N terminal of ANXA13 corresponding to a region with amino acids KKLNKACKGMGTNEAAIIEILSGRTSDERQQIKQKYKATYGKELEEVLKS
Purity/Format Total IgG Protein A purified
Blocking Peptide Annexin A13 Blocking Peptide
Description Rabbit polyclonal Annexin A13 antibody raised against the N terminal of ANXA13
Gene ANXA13
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.