| Name | BCAP29 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7550 |
| Prices | $375.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | BCAP29 antibody was raised using the middle region of BCAP29 corresponding to a region with amino acids GVMEPQQRNADSHQKLEEAKNRFFPRASSSRSMALQIPIKLILDFLASRT |
| Purity/Format | Affinity purified |
| Blocking Peptide | BCAP29 Blocking Peptide |
| Description | Rabbit polyclonal BCAP29 antibody raised against the middle region of BCAP29 |
| Gene | BCAP29 |
| Supplier Page | Shop |