| Name | PRPS2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4429 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | PRPS2 antibody was raised using the N terminal of PRPS2 corresponding to a region with amino acids PNIVLFSGSSHQDLSQRVADRLGLELGKVVTKKFSNQETSVEIGESVRGE |
| Purity/Format | Affinity purified |
| Blocking Peptide | PRPS2 Blocking Peptide |
| Description | Rabbit polyclonal PRPS2 antibody raised against the N terminal of PRPS2 |
| Gene | PRPS2 |
| Supplier Page | Shop |