KLRC3 antibody

• Supplier: Fitzgerald
• Catalog: 70R-6843
• Prices: $345.00
• Sizes: 50 µg
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: KLRC3 antibody was raised using the N terminal of KLRC3 corresponding to a region with amino acids MSKQRGTFSEVSLAQDPKWQQRKPKGNKSSISGTEQEIFQVELNLQNASL
• Purity/Format: Affinity purified
• Blocking Peptide: KLRC3 Blocking Peptide
• Description: Rabbit polyclonal KLRC3 antibody raised against the N terminal of KLRC3
• Gene: KLRC3