| Name | PTK2B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1706 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | PTK2B antibody was raised using the C terminal of PTK2B corresponding to a region with amino acids QKQMVEDYQWLRQEEKSLDPMVYMNDKSPLTPEKEVGYLEFTGPPQKPPR |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | PTK2B Blocking Peptide |
| Description | Rabbit polyclonal PTK2B antibody raised against the C terminal of PTK2B |
| Gene | PTK2B |
| Supplier Page | Shop |