| Name | DRB1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1352 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | DRB1 antibody was raised using the N terminal of DRB1 corresponding to a region with amino acids MDEAGSSASGGGFRPGVDSLDEPPNSRIFLVISKYTPESVLRERFSPFGD |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | DRB1 Blocking Peptide |
| Description | Rabbit polyclonal DRB1 antibody raised against the N terminal of DRB1 |
| Gene | RBM45 |
| Supplier Page | Shop |