| Name | UBASH3A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2635 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | UBASH3A antibody was raised using the middle region of UBASH3A corresponding to a region with amino acids PCSLPRRSRGIKDFENDPPLSSCGIFQSRIAGDALLDSGIRISSVFASPA |
| Purity/Format | Affinity purified |
| Blocking Peptide | UBASH3A Blocking Peptide |
| Description | Rabbit polyclonal UBASH3A antibody raised against the middle region of UBASH3A |
| Gene | CLIP4 |
| Supplier Page | Shop |