| Name | TMCO3 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7422 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Rat |
| Antigen | TMCO3 antibody was raised using the N terminal of TMCO3 corresponding to a region with amino acids KTAIGAVEKDVGLSDEEKLFQVHTFEIFQKELNESENSVFQAVYGLQRAL |
| Purity/Format | Affinity purified |
| Blocking Peptide | TMCO3 Blocking Peptide |
| Description | Rabbit polyclonal TMCO3 antibody raised against the N terminal of TMCO3 |
| Gene | TMCO3 |
| Supplier Page | Shop |