| Name | FLJ20674 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7427 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | FLJ20674 antibody was raised using the N terminal of FLJ20674 corresponding to a region with amino acids LNVTQWFQVWLQVASGPYQIEVHIVATGTLPNGTLYAARGSQVDFSCNSS |
| Purity/Format | Affinity purified |
| Blocking Peptide | FLJ20674 Blocking Peptide |
| Description | Rabbit polyclonal FLJ20674 antibody raised against the N terminal of FLJ20674 |
| Gene | VSIG10 |
| Supplier Page | Shop |