| Name | C6ORF21 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1743 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | C6ORF21 antibody was raised using the N terminal Of C6Orf21 corresponding to a region with amino acids CSPAAGSFTTLVAQVQVGRPAPDPGKPGRESRLRLLGNYSLWLEGSKEED |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | C6ORF21 Blocking Peptide |
| Description | Rabbit polyclonal C6ORF21 antibody raised against the N terminal Of C6Orf21 |
| Gene | LY6G6F |
| Supplier Page | Shop |