| Name | SDS antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3762 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | SDS antibody was raised using the middle region of SDS corresponding to a region with amino acids KITSVAKALGVKTVGAQALKLFQEHPIFSEVISDQEAVAAIEKFVDDEKI |
| Purity/Format | Affinity purified |
| Blocking Peptide | SDS Blocking Peptide |
| Description | Rabbit polyclonal SDS antibody raised against the middle region of SDS |
| Gene | SDS |
| Supplier Page | Shop |