| Name | FAM124A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3890 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | FAM124A antibody was raised using the middle region of FAM124A corresponding to a region with amino acids VSRVTTEASWASLPFFTKRSSSSSATARAAPPAPSTSTLTDSSPQLPCDT |
| Purity/Format | Affinity purified |
| Blocking Peptide | FAM124A Blocking Peptide |
| Description | Rabbit polyclonal FAM124A antibody raised against the middle region of FAM124A |
| Gene | FAM124A |
| Supplier Page | Shop |