DLG3 antibody

Name DLG3 antibody
Supplier Fitzgerald
Catalog 70R-6528
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen DLG3 antibody was raised using a synthetic peptide corresponding to a region with amino acids FPHKFGSCVPHTTRPRRDNEVDGQDYHFVVSREQMEKDIQDNKFIEAGQF
Purity/Format Affinity purified
Blocking Peptide DLG3 Blocking Peptide
Description Rabbit polyclonal DLG3 antibody
Gene DLG3
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.