| Name | ITFG1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6176 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | ITFG1 antibody was raised using the N terminal of ITFG1 corresponding to a region with amino acids TAELFGAEAWGTLAAFGDLNSDKQTDLFVLRERNDLIVFLADQNAPYFKP |
| Purity/Format | Affinity purified |
| Blocking Peptide | ITFG1 Blocking Peptide |
| Description | Rabbit polyclonal ITFG1 antibody raised against the N terminal of ITFG1 |
| Gene | ITFG1 |
| Supplier Page | Shop |