| Name | FBXO42 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3602 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | FBXO42 antibody was raised using the middle region of FBXO42 corresponding to a region with amino acids RSMDEAPCVNGRWGTLRPRAQRQTPSGSREGSLSPARGDGSPILNGGSLS |
| Purity/Format | Affinity purified |
| Blocking Peptide | FBXO42 Blocking Peptide |
| Description | Rabbit polyclonal FBXO42 antibody raised against the middle region of FBXO42 |
| Gene | FBXO42 |
| Supplier Page | Shop |