| Name | GPR177 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6560 |
| Prices | $375.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Dog |
| Antigen | GPR177 antibody was raised using the N terminal of GPR177 corresponding to a region with amino acids ARKNHHKTKWFVPWGPNHCDKIRDIEEAIPREIEANDIVFSVHIPLPHME |
| Purity/Format | Affinity purified |
| Blocking Peptide | GPR177 Blocking Peptide |
| Description | Rabbit polyclonal GPR177 antibody raised against the N terminal of GPR177 |
| Gene | WLS |
| Supplier Page | Shop |