| Name | ZNF14 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3249 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | ZNF14 antibody was raised using the N terminal of ZNF14 corresponding to a region with amino acids IYYQPFQRHERTHAGQKPYECKQCGKTFIYYQSFQKHAHTGKKPYECKQC |
| Purity/Format | Affinity purified |
| Blocking Peptide | ZNF14 Blocking Peptide |
| Description | Rabbit polyclonal ZNF14 antibody raised against the N terminal of ZNF14 |
| Gene | ZNF14 |
| Supplier Page | Shop |