| Name | PRKACB antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2704 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | PRKACB antibody was raised using the middle region of PRKACB corresponding to a region with amino acids NGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEDI |
| Purity/Format | Affinity purified |
| Blocking Peptide | PRKACB Blocking Peptide |
| Description | Rabbit polyclonal PRKACB antibody raised against the middle region of PRKACB |
| Gene | PRKACB |
| Supplier Page | Shop |