KCTD17 antibody

• Supplier: Fitzgerald
• Catalog: 70R-5074
• Prices: $345.00
• Sizes: 50 µg
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: KCTD17 antibody was raised using the middle region of KCTD17 corresponding to a region with amino acids YGSEDQAEFLCVVSKELHSTPNGLSSESSRKTKSTEEQLEEQQQQEEEVE
• Purity/Format: Affinity purified
• Blocking Peptide: KCTD17 Blocking Peptide
• Description: Rabbit polyclonal KCTD17 antibody raised against the middle region of KCTD17
• Gene: KCTD17