| Name | STK38L antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4530 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | STK38L antibody was raised using the middle region of STK38L corresponding to a region with amino acids PAAIPIEIKSIDDTSNFDDFPESDILQPVPNTTEPDYKSKDWVFLNYTYK |
| Purity/Format | Affinity purified |
| Blocking Peptide | STK38L Blocking Peptide |
| Description | Rabbit polyclonal STK38L antibody raised against the middle region of STK38L |
| Gene | STK38L |
| Supplier Page | Shop |