| Name | JAKMIP1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4722 |
| Prices | $375.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | JAKMIP1 antibody was raised using the middle region of JAKMIP1 corresponding to a region with amino acids FLRLQVLEQQHVIDDLSLERERLLRSKRHRGKSLKPPKKHVVETFFGFDE |
| Purity/Format | Affinity purified |
| Blocking Peptide | JAKMIP1 Blocking Peptide |
| Description | Rabbit polyclonal JAKMIP1 antibody raised against the middle region of JAKMIP1 |
| Gene | JAKMIP1 |
| Supplier Page | Shop |