| Name | C11ORF65 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3634 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | C11ORF65 antibody was raised using the N terminal Of C11Orf65 corresponding to a region with amino acids MPWKEESEFTKQDKAARVIQQAWKSFLNVAIFQHFKSLIDLRRQGEPRQI |
| Purity/Format | Affinity purified |
| Blocking Peptide | C11ORF65 Blocking Peptide |
| Description | Rabbit polyclonal C11ORF65 antibody raised against the N terminal Of C11Orf65 |
| Gene | C11orf65 |
| Supplier Page | Shop |